Lineage for d7ea9b1 (7ea9 B:72-221)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400092Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)
  8. 2400102Domain d7ea9b1: 7ea9 B:72-221 [401995]
    Other proteins in same PDB: d7ea9a2, d7ea9b2, d7ea9c2, d7ea9d2
    automated match to d3bjua1
    complexed with gol, kaa; mutant

Details for d7ea9b1

PDB Entry: 7ea9 (more details), 2.5 Å

PDB Description: crystal structure of human lysyl-trna synthetase y145h mutant
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d7ea9b1:

Sequence, based on SEQRES records: (download)

>d7ea9b1 b.40.4.0 (B:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifhdlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records): (download)

>d7ea9b1 b.40.4.0 (B:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifhdlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphlk

SCOPe Domain Coordinates for d7ea9b1:

Click to download the PDB-style file with coordinates for d7ea9b1.
(The format of our PDB-style files is described here.)

Timeline for d7ea9b1: