Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
Domain d7ea9a1: 7ea9 A:71-221 [401988] Other proteins in same PDB: d7ea9a2, d7ea9b2, d7ea9c2, d7ea9d2 automated match to d3bjua1 complexed with gol, kaa; mutant |
PDB Entry: 7ea9 (more details), 2.5 Å
SCOPe Domain Sequences for d7ea9a1:
Sequence, based on SEQRES records: (download)
>d7ea9a1 b.40.4.0 (A:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag rihakrasggklifhdlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk tkkgelsiipyeitllspclhmlphlhfglk
>d7ea9a1 b.40.4.0 (A:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag rihakrasggklifhdlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk tkkgelsiipyeitllspclhmlphglk
Timeline for d7ea9a1: