Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries) |
Domain d7ea9c2: 7ea9 C:222-575 [401983] Other proteins in same PDB: d7ea9a1, d7ea9b1, d7ea9c1, d7ea9d1 automated match to d3bjua2 complexed with gol, kaa; mutant |
PDB Entry: 7ea9 (more details), 2.5 Å
SCOPe Domain Sequences for d7ea9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ea9c2 d.104.1.0 (C:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]} dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp
Timeline for d7ea9c2: