SCOPe 2.08: Domain d7d1ud_: 7d1u D:

Lineage for d7d1ud_ (7d1u D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries)

8. Domain d7d1ud_: 7d1u D: [401920]
   Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ue_, d7d1uf_, d7d1uh_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1ux_, d7d1uz_
   automated match to d5zznd_
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1ud_

PDB Entry: 7d1u, 2.08 Å

PDB Description: cryo-em structure of psii at 2.08 angstrom resolution

PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d7d1ud_:

Sequence; same for both SEQRES and ATOM records:

>d7d1ud_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqpxenfvfpeevlprgnal

Timeline for d7d1ud_:

• d7d1ud_ first appeared in SCOPe 2.07