Lineage for d7d1ud_ (7d1u D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027631Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries)
  8. 3027648Domain d7d1ud_: 7d1u D: [401920]
    Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ue_, d7d1uf_, d7d1uh_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1ux_, d7d1uz_
    automated match to d5zznd_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1ud_

PDB Entry: 7d1u (more details), 2.08 Å

PDB Description: cryo-em structure of psii at 2.08 angstrom resolution
PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d7d1ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d1ud_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqpxenfvfpeevlprgnal

SCOPe Domain Coordinates for d7d1ud_:

Click to download the PDB-style file with coordinates for d7d1ud_.
(The format of our PDB-style files is described here.)

Timeline for d7d1ud_: