Lineage for d1typa3 (1typ A:359-487)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331582Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 331583Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 331584Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (9 proteins)
  6. 331678Protein Trypanothione reductase [55429] (2 species)
  7. 331679Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 331690Domain d1typa3: 1typ A:359-487 [40186]
    Other proteins in same PDB: d1typa1, d1typa2, d1typb1, d1typb2

Details for d1typa3

PDB Entry: 1typ (more details), 2.8 Å

PDB Description: substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution

SCOP Domain Sequences for d1typa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1typa3 d.87.1.1 (A:359-487) Trypanothione reductase {Crithidia fasciculata}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
qkgkrveki

SCOP Domain Coordinates for d1typa3:

Click to download the PDB-style file with coordinates for d1typa3.
(The format of our PDB-style files is described here.)

Timeline for d1typa3: