SCOP 1.65: Domain d1typb2: 1typ B:170-286

Lineage for d1typb2 (1typ B:170-286)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Trypanothione reductase [51947] (2 species)

7. Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)

8. Domain d1typb2: 1typ B:170-286 [30512]
   Other proteins in same PDB: d1typa3, d1typb3
   complexed with fad, gsh, nap, spd

Details for d1typb2

PDB Entry: 1typ, 2.8 Å

PDB Description: substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution

SCOP Domain Sequences for d1typb2:

Sequence; same for both SEQRES and ATOM records:

>d1typb2 c.3.1.5 (B:170-286) Trypanothione reductase {Crithidia fasciculata}
egddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrg
fdselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaig

Timeline for d1typb2:

• d1typb2 first appeared (with stable ids) in SCOP 1.55
  
• d1typb2 appears in SCOP 1.63
  
• d1typb2 appears in SCOP 1.67
  
• d1typb2 appears in the current release, SCOPe 2.08