Lineage for d6m6ea_ (6m6e A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2792043Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2792044Protein automated matches [190764] (2 species)
    not a true protein
  7. 2792052Species Human (Homo sapiens) [TaxId:9606] [187978] (13 PDB entries)
  8. 2792069Domain d6m6ea_: 6m6e A: [400036]
    automated match to d1nuna_

Details for d6m6ea_

PDB Entry: 6m6e (more details)

PDB Description: solution structure of the core domain of fibroblast growth factor 21 (fgf21)
PDB Compounds: (A:) Fibroblast growth factor 21

SCOPe Domain Sequences for d6m6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m6ea_ b.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqvrqrylytddaqqteahleiredgtvggaadqspesllqlkalkpgviqilgvktsrf
lcqrpdgalygslhfdpeacsfrellledgynvyqseahglplhlpgnksphrdpaprgp
arflplpg

SCOPe Domain Coordinates for d6m6ea_:

Click to download the PDB-style file with coordinates for d6m6ea_.
(The format of our PDB-style files is described here.)

Timeline for d6m6ea_: