SCOPe 2.08: Domain d6lujc1: 6luj C:459-523

Lineage for d6lujc1 (6luj C:459-523)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d6lujc1: 6luj C:459-523 [399974]
   Other proteins in same PDB: d6luja2, d6lujb2, d6lujc2, d6lujd2, d6luje2
   automated match to d1pk1d_
   complexed with so4

Details for d6lujc1

PDB Entry: 6luj, 1.12 Å

PDB Description: crystal structure of the samd1 sam domain

PDB Compounds: (C:) Atherin

SCOPe Domain Sequences for d6lujc1:

Sequence; same for both SEQRES and ATOM records:

>d6lujc1 a.60.1.0 (C:459-523) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvewtvmdvveyfteagfpeqatafqeqeidgkslllmqrtdvltglsirlgpalkiyeh
hikvl

Timeline for d6lujc1:

• d6lujc1 first appeared in SCOPe 2.07