Lineage for d2dap_2 (2dap 119-268)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (2 proteins) Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species) Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries) 
Domain d2dap_2: 2dap 119-268 [39965]
Other proteins in same PDB: d2dap_1
Details for d2dap_2
PDB Entry: 2dap (more details), 2.2 Å
PDB Description: c. glutamicum dap dehydrogenase in complex with dap
SCOP Domain Sequences for d2dap_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dap_2 d.81.1.3 (119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld
SCOP Domain Coordinates for d2dap_2:
Click to download the PDB-style file with coordinates for d2dap_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dap_2:
- d2dap_2 first appeared (with stable ids) in SCOP 1.55
- d2dap_2 appears in SCOP 1.59
- d2dap_2 appears in the current release, SCOPe 2.08, called d2dapa2
View in 3D
