Lineage for d7kmib1 (7kmi B:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365787Domain d7kmib1: 7kmi B:1-107 [399335]
    Other proteins in same PDB: d7kmib2, d7kmic1, d7kmic2
    automated match to d1dn0a1
    complexed with gol, nag

Details for d7kmib1

PDB Entry: 7kmi (more details), 1.73 Å

PDB Description: ly-cov481 neutralizing antibody against sars-cov-2
PDB Compounds: (B:) LY-CoV481 Fab light chain

SCOPe Domain Sequences for d7kmib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kmib1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspssvsasvgdrvtitcrasqgisswlawyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqansfpggtfgpgtkvdi

SCOPe Domain Coordinates for d7kmib1:

Click to download the PDB-style file with coordinates for d7kmib1.
(The format of our PDB-style files is described here.)

Timeline for d7kmib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7kmib2