SCOPe 2.08: Domain d7kmib1: 7kmi B:1-107

Lineage for d7kmib1 (7kmi B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7kmib1: 7kmi B:1-107 [399335]
   Other proteins in same PDB: d7kmia1, d7kmia2, d7kmib2, d7kmic1, d7kmic2
   automated match to d1dn0a1
   complexed with gol, nag

Details for d7kmib1

PDB Entry: 7kmi, 1.73 Å

PDB Description: ly-cov481 neutralizing antibody against sars-cov-2

PDB Compounds: (B:) LY-CoV481 Fab light chain

SCOPe Domain Sequences for d7kmib1:

Sequence; same for both SEQRES and ATOM records:

>d7kmib1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspssvsasvgdrvtitcrasqgisswlawyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqansfpggtfgpgtkvdi

Timeline for d7kmib1:

• d7kmib1 first appeared in SCOPe 2.07