SCOPe 2.08: Domain d7kbla2: 7kbl A:115-328

Lineage for d7kbla2 (7kbl A:115-328)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Hydrogenobacter thermophilus [TaxId:940] [399167] (3 PDB entries)

8. Domain d7kbla2: 7kbl A:115-328 [399173]
   Other proteins in same PDB: d7kbla1, d7kbla3, d7kbla4, d7kblb1, d7kblb3
   automated match to d1ulza3
   complexed with bct

Details for d7kbla2

PDB Entry: 7kbl, 2.3 Å

PDB Description: biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to bicarbonate

PDB Compounds: (A:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kbla2:

Sequence, based on SEQRES records:

>d7kbla2 d.142.1.0 (A:115-328) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
karskevmkragvptvpgsdgilkdveeakriakeigypvllkasaggggrgiricrnee
elvrnyenayneavkafgrgdlllekyienpkhiefqvlgdkygnvihlgerdcsiqrrn
qklveiapsllltpeqreyygslvvkaakeigyysagtmefiadekgnlyfiemntriqv
ehpvtemitgvdivkwqiriaagerlrysqedir

Sequence, based on observed residues (ATOM records):

>d7kbla2 d.142.1.0 (A:115-328) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
karskevmkragvptvpgsdgilkdveeakriakeigypvllkasricrneeelvrnyen
ayneavkafgrgdlllekyienpkhiefqvlgdkygnvihlgerdcsiqrrnqklveiap
sllltpeqreyygslvvkaakeigyysagtmefiadekgnlyfiemntriqvehpvtemi
tgvdivkwqiriaagerlrysqedir

Timeline for d7kbla2:

• d7kbla2 first appeared in SCOPe 2.07