Lineage for d1cf2p2 (1cf2 P:139-303)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421944Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1421945Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1421946Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1422023Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1422124Species Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry)
  8. 1422126Domain d1cf2p2: 1cf2 P:139-303 [39911]
    Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1
    complexed with nap, so4

Details for d1cf2p2

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus
PDB Compounds: (P:) protein (glyceraldehyde-3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1cf2p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2p2 d.81.1.1 (P:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus [TaxId: 2180]}
scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv
ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst
aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd

SCOPe Domain Coordinates for d1cf2p2:

Click to download the PDB-style file with coordinates for d1cf2p2.
(The format of our PDB-style files is described here.)

Timeline for d1cf2p2: