Lineage for d1cf2p2 (1cf2 P:139-303)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. Species Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry)
  8. Domain d1cf2p2: 1cf2 P:139-303 [39911]
    Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1

Details for d1cf2p2

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

SCOP Domain Sequences for d1cf2p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2p2 d.81.1.1 (P:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus}
scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv
ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst
aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd

SCOP Domain Coordinates for d1cf2p2 are not available.

Timeline for d1cf2p2:

Domains from same chain:
(mouse over for more information)
d1cf2p1
Domains from other chains:
(mouse over for more information)
d1cf2o1, d1cf2o2, d1cf2q1, d1cf2q2, d1cf2r1, d1cf2r2