Lineage for d1cf2o1 (1cf2 O:1-138,O:304-336)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348180Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1348407Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1348508Species Methanothermus fervidus [TaxId:2180] [51807] (1 PDB entry)
  8. 1348509Domain d1cf2o1: 1cf2 O:1-138,O:304-336 [29994]
    Other proteins in same PDB: d1cf2o2, d1cf2p2, d1cf2q2, d1cf2r2
    complexed with nap, so4

Details for d1cf2o1

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus
PDB Compounds: (O:) protein (glyceraldehyde-3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1cf2o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus [TaxId: 2180]}
mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
nslsnyeesygkdytrvvXivpenvdavrailemeedkyksinktnkamnil

SCOPe Domain Coordinates for d1cf2o1:

Click to download the PDB-style file with coordinates for d1cf2o1.
(The format of our PDB-style files is described here.)

Timeline for d1cf2o1: