SCOPe 2.07: Domain d7jgwa1: 7jgw A:1-196

Lineage for d7jgwa1 (7jgw A:1-196)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries)

8. Domain d7jgwa1: 7jgw A:1-196 [398965]
   Other proteins in same PDB: d7jgwa2
   automated match to d4z9vb_
   complexed with v9s

Details for d7jgwa1

PDB Entry: 7jgw, 1.3 Å

PDB Description: crystal structure of bcl-xl in complex with compound 1620116, crystal form 1

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d7jgwa1:

Sequence; same for both SEQRES and ATOM records:

>d7jgwa1 f.1.4.1 (A:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

Timeline for d7jgwa1:

• d7jgwa1 is new in SCOPe 2.07-stable
  
• d7jgwa1 appears in the current release, SCOPe 2.08