Lineage for d1fw6b4 (1fw6 B:1001-1120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958380Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) (S)
    automatically mapped to Pfam PF01624
  5. 2958381Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 2958382Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 2958399Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries)
  8. 2958405Domain d1fw6b4: 1fw6 B:1001-1120 [39746]
    Other proteins in same PDB: d1fw6a1, d1fw6a2, d1fw6a3, d1fw6b1, d1fw6b2, d1fw6b3
    protein/DNA complex; complexed with adp, mg, so4

Details for d1fw6b4

PDB Entry: 1fw6 (more details), 2.7 Å

PDB Description: crystal structure of a taq muts-dna-adp ternary complex
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1fw6b4:

Sequence, based on SEQRES records: (download)

>d1fw6b4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

Sequence, based on observed residues (ATOM records): (download)

>d1fw6b4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepvrrevtqlltpgt

SCOPe Domain Coordinates for d1fw6b4:

Click to download the PDB-style file with coordinates for d1fw6b4.
(The format of our PDB-style files is described here.)

Timeline for d1fw6b4: