| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) ![]() automatically mapped to Pfam PF01624 |
| Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
| Protein DNA repair protein MutS, domain I [55273] (2 species) |
| Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries) |
| Domain d1fw6a4: 1fw6 A:1-120 [39745] Other proteins in same PDB: d1fw6a1, d1fw6a2, d1fw6a3, d1fw6b1, d1fw6b2, d1fw6b3 protein/DNA complex; complexed with adp, mg, so4 |
PDB Entry: 1fw6 (more details), 2.7 Å
SCOPe Domain Sequences for d1fw6a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fw6a4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
Timeline for d1fw6a4:
View in 3DDomains from other chains: (mouse over for more information) d1fw6b1, d1fw6b2, d1fw6b3, d1fw6b4 |