Lineage for d1bdfb1 (1bdf B:1-52,B:179-235)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200525Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2200656Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2200657Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 2200658Protein RNA polymerase alpha [55259] (3 species)
  7. 2200659Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)
  8. 2200661Domain d1bdfb1: 1bdf B:1-52,B:179-235 [39728]
    Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2

Details for d1bdfb1

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain
PDB Compounds: (B:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1bdfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdfb1 d.74.3.1 (B:1-52,B:179-235) RNA polymerase alpha {Escherichia coli [TaxId: 562]}
mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay
nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr

SCOPe Domain Coordinates for d1bdfb1:

Click to download the PDB-style file with coordinates for d1bdfb1.
(The format of our PDB-style files is described here.)

Timeline for d1bdfb1: