Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.74: DCoH-like [55247] (4 superfamilies) |
Superfamily d.74.3: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55257] (1 family) |
Family d.74.3.1: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55258] (1 protein) |
Protein Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55259] (1 species) |
Species Escherichia coli [TaxId:562] [55260] (1 PDB entry) |
Domain d1bdfb1: 1bdf B:1-52,B:179-235 [39728] Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2 |
PDB Entry: 1bdf (more details), 2.5 Å
SCOP Domain Sequences for d1bdfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdfb1 d.74.3.1 (B:1-52,B:179-235) Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain {Escherichia coli} mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
Timeline for d1bdfb1: