![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) ![]() forms trimers with three closely packed beta-sheets |
![]() | Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein) |
![]() | Protein C-terminal domain of arginine repressor [55254] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries) |
![]() | Domain d1b4ab2: 1b4a B:79-149 [39722] Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1 |
PDB Entry: 1b4a (more details), 2.5 Å
SCOP Domain Sequences for d1b4ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4ab2 d.74.2.1 (B:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]} alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda kkvsnqllsml
Timeline for d1b4ab2: