Lineage for d1b4ab2 (1b4a B:79-149)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031575Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1031631Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) (S)
    forms trimers with three closely packed beta-sheets
  5. 1031632Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
  6. 1031633Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 1031634Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)
  8. 1031639Domain d1b4ab2: 1b4a B:79-149 [39722]
    Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1

Details for d1b4ab2

PDB Entry: 1b4a (more details), 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus
PDB Compounds: (B:) Arginine repressor

SCOPe Domain Sequences for d1b4ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ab2 d.74.2.1 (B:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

SCOPe Domain Coordinates for d1b4ab2:

Click to download the PDB-style file with coordinates for d1b4ab2.
(The format of our PDB-style files is described here.)

Timeline for d1b4ab2: