SCOP 1.75: Structural Classification of Proteins

PDB entry 1b4a

View 1b4a on RCSB PDB site
Description: structure of the arginine repressor from bacillus stearothermophilus
Class: repressor
Keywords: repressor, arginine, helix turn helix
Deposited on 1998-12-18, released 1999-06-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Arginine repressor
Species: Bacillus stearothermophilus
Database cross-references and differences (RAF-indexed):
- Uniprot O31408 (Start-148)
Domains in SCOP 1.75: d1b4aa1, d1b4aa2
Chain 'B':
Compound: Arginine repressor
Species: Bacillus stearothermophilus
Database cross-references and differences (RAF-indexed):
- Uniprot O31408 (Start-148)
Domains in SCOP 1.75: d1b4ab1, d1b4ab2
Chain 'C':
Compound: Arginine repressor
Species: Bacillus stearothermophilus
Database cross-references and differences (RAF-indexed):
- Uniprot O31408 (Start-148)
Domains in SCOP 1.75: d1b4ac1, d1b4ac2
Chain 'D':
Compound: Arginine repressor
Species: Bacillus stearothermophilus
Database cross-references and differences (RAF-indexed):
- Uniprot O31408 (Start-148)
Domains in SCOP 1.75: d1b4ad1, d1b4ad2
Chain 'E':
Compound: Arginine repressor
Species: Bacillus stearothermophilus
Database cross-references and differences (RAF-indexed):
- Uniprot O31408 (Start-148)
Domains in SCOP 1.75: d1b4ae1, d1b4ae2
Chain 'F':
Compound: Arginine repressor
Species: Bacillus stearothermophilus
Database cross-references and differences (RAF-indexed):
- Uniprot O31408 (Start-148)
Domains in SCOP 1.75: d1b4af1, d1b4af2
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1b4aA (A:)
lnkgqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangry
kyslpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivg
ticgddtcliicrtpkdakkvsnqllsml