Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries) |
Domain d7k5hg_: 7k5h G: [397043] automated match to d4e6ka_ complexed with hem, k, vxv |
PDB Entry: 7k5h (more details), 1.9 Å
SCOPe Domain Sequences for d7k5hg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5hg_ a.25.1.1 (G:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll kdileseeehidyletqlgliqkvglenylqshmhe
Timeline for d7k5hg_: