Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins) |
Protein automated matches [195794] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [396510] (9 PDB entries) |
Domain d6z80h_: 6z80 H: [396679] Other proteins in same PDB: d6z80k_, d6z80l_, d6z80m_, d6z80n_, d6z80o_, d6z80p_, d6z80q_, d6z80r_, d6z80s_, d6z80t_ automated match to d1fb1a_ complexed with 8gt, phe, zn |
PDB Entry: 6z80 (more details), 3 Å
SCOPe Domain Sequences for d6z80h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z80h_ d.96.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetisdvlndaifdedhd emvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklariveiysrrlqvqerltk qiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvfredpktreefltl ir
Timeline for d6z80h_: