Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165 |
Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) automatically mapped to Pfam PF06399 |
Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins) |
Protein automated matches [394245] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [394246] (7 PDB entries) |
Domain d6z80n_: 6z80 N: [396673] Other proteins in same PDB: d6z80a_, d6z80b_, d6z80c_, d6z80d_, d6z80e_, d6z80f_, d6z80g_, d6z80h_, d6z80i_, d6z80j_ automated match to d1wplk_ complexed with 8gt, phe, zn |
PDB Entry: 6z80 (more details), 3 Å
SCOPe Domain Sequences for d6z80n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z80n_ d.205.1.1 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpyllistqirmevgptmvgdeqsdpelmqhlgaskrralgnnfyeyyvddpprivldkl errgfrvlsmtgvgqtlvwclhk
Timeline for d6z80n_: