![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) |
![]() | Domain d1rxoc_: 1rxo C: [39642] Other proteins in same PDB: d1rxob1, d1rxob2, d1rxoe1, d1rxoe2, d1rxoh1, d1rxoh2, d1rxol1, d1rxol2 |
PDB Entry: 1rxo (more details), 2.2 Å
SCOP Domain Sequences for d1rxoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxoc_ d.73.1.1 (C:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)} mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp agy
Timeline for d1rxoc_: