SCOP 1.65: Domain d1rxoh2: 1rxo H:9-147

Lineage for d1rxoh2 (1rxo H:9-147)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)

8. Domain d1rxoh2: 1rxo H:9-147 [39260]
   Other proteins in same PDB: d1rxob1, d1rxoc_, d1rxoe1, d1rxof_, d1rxoh1, d1rxoi_, d1rxol1, d1rxos_
   complexed with ca, rub

Details for d1rxoh2

PDB Entry: 1rxo, 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

SCOP Domain Sequences for d1rxoh2:

Sequence; same for both SEQRES and ATOM records:

>d1rxoh2 d.58.9.1 (H:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

Timeline for d1rxoh2:

• d1rxoh2 first appeared (with stable ids) in SCOP 1.55
  
• d1rxoh2 appears in SCOP 1.63
  
• d1rxoh2 appears in SCOP 1.67
  
• d1rxoh2 appears in the current release, SCOPe 2.08