SCOPe 2.08: Domain d6lvta_: 6lvt A:

Lineage for d6lvta_ (6lvt A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [384042] (2 PDB entries)

8. Domain d6lvta_: 6lvt A: [395348]
   automated match to d1x3oa_

Details for d6lvta_

PDB Entry: 6lvt

PDB Description: solution structure of holo acyl carrier protein from thermotoga maritima

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d6lvta_:

Sequence; same for both SEQRES and ATOM records:

>d6lvta_ a.28.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
masreeifskvksiiseklgvdesqvteeakliddlgadsldlvdlvmdfesefgvkvdd
adlekistvgdivsyiekklg

Timeline for d6lvta_:

• d6lvta_ first appeared in SCOPe 2.07