Lineage for d7k61f_ (7k61 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698556Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries)
  8. 2698601Domain d7k61f_: 7k61 F: [394912]
    Other proteins in same PDB: d7k61a_, d7k61c_, d7k61d_, d7k61e_, d7k61g_, d7k61h_, d7k61m1, d7k61m2, d7k61n1, d7k61n2
    automated match to d1tzyd_
    protein/DNA complex

Details for d7k61f_

PDB Entry: 7k61 (more details), 2.85 Å

PDB Description: cryo-em structure of 197bp nucleosome aided by scfv
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d7k61f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k61f_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d7k61f_:

Click to download the PDB-style file with coordinates for d7k61f_.
(The format of our PDB-style files is described here.)

Timeline for d7k61f_: