Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries) |
Domain d7k61f_: 7k61 F: [394912] Other proteins in same PDB: d7k61a_, d7k61c_, d7k61d_, d7k61e_, d7k61g_, d7k61h_, d7k61m1, d7k61m2, d7k61n1, d7k61n2 automated match to d1tzyd_ protein/DNA complex |
PDB Entry: 7k61 (more details), 2.85 Å
SCOPe Domain Sequences for d7k61f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k61f_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]} kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk tvtamdvvyalkrqgrtlygfgg
Timeline for d7k61f_: