SCOPe 2.08: Domain d7k61m1: 7k61 M:19-126

Lineage for d7k61m1 (7k61 M:19-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d7k61m1: 7k61 M:19-126 [394985]
   Other proteins in same PDB: d7k61a_, d7k61b_, d7k61c_, d7k61d_, d7k61e_, d7k61f_, d7k61g_, d7k61h_
   automated match to d4f9lc1
   protein/DNA complex

Details for d7k61m1

PDB Entry: 7k61, 2.85 Å

PDB Description: cryo-em structure of 197bp nucleosome aided by scfv

PDB Compounds: (M:) scFv20

SCOPe Domain Sequences for d7k61m1:

Sequence; same for both SEQRES and ATOM records:

>d7k61m1 b.1.1.0 (M:19-126) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdikmtqspssmhaslgervtitckasqdirsylswyqqkpwkspktliyyatsladgvp
srfsgsgsgqdfsltinnlesddtatyyclqhgespytfgsgtkleik

Timeline for d7k61m1:

• d7k61m1 first appeared in SCOPe 2.07