SCOPe 2.08: Domain d7d3da_: 7d3d A:

Lineage for d7d3da_ (7d3d A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein Speckle-type poz protein SPOP [141107] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries)
   Uniprot O43791 28-173

8. Domain d7d3da_: 7d3d A: [394504]
   automated match to d3hqma_
   complexed with gol

Details for d7d3da_

PDB Entry: 7d3d, 1.45 Å

PDB Description: crystal structure of spop bound with a peptide

PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d7d3da_:

Sequence; same for both SEQRES and ATOM records:

>d7d3da_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvqd

Timeline for d7d3da_:

• d7d3da_ first appeared in SCOPe 2.07