SCOPe 2.07: Domain d6zshb_: 6zsh B:

Lineage for d6zshb_ (6zsh B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d6zshb_: 6zsh B: [394170]
   automated match to d1bkra_

Details for d6zshb_

PDB Entry: 6zsh, 2.2 Å

PDB Description: the mechanism of activation of the actin binding protein ehbp1 by rab8 family members

PDB Compounds: (B:) EH domain-binding protein 1

SCOPe Domain Sequences for d6zshb_:

Sequence; same for both SEQRES and ATOM records:

>d6zshb_ a.40.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidykslnpqdike
nnkkaydgfasigisrllepsdmvllaipdkltvmtylyqirahfsgq

Timeline for d6zshb_:

• d6zshb_ is new in SCOPe 2.07-stable
  
• d6zshb_ appears in the current release, SCOPe 2.08