PDB entry 6zsh

View 6zsh on RCSB PDB site
Description: The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members
Class: endocytosis
Keywords: Rab GTPase, EHBP1, bMERB domain, CH domain, ENDOCYTOSIS
Deposited on 2020-07-15, released 2020-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EH domain-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHBP1, KIAA0903, NACSIN
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: EH domain-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHBP1, KIAA0903, NACSIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6zshb_
  • Chain 'C':
    Compound: EH domain-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHBP1, KIAA0903, NACSIN
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: EH domain-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHBP1, KIAA0903, NACSIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6zshd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6zshB (B:)
    ghmgrkpnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidyksln
    pqdikennkkaydgfasigisrllepsdmvllaipdkltvmtylyqirahfsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zshB (B:)
    pnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidykslnpqdike
    nnkkaydgfasigisrllepsdmvllaipdkltvmtylyqirahfsgq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6zshD (D:)
    ghmgrkpnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidyksln
    pqdikennkkaydgfasigisrllepsdmvllaipdkltvmtylyqirahfsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zshD (D:)
    pnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidykslnpqdike
    nnkkaydgfasigisrllepsdmvllaipdkltvmtylyqirahfs