Lineage for d1bkra_ (1bkr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325183Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2325194Protein beta-spectrin [47578] (1 species)
  7. 2325195Species Human (Homo sapiens) [TaxId:9606] [47579] (2 PDB entries)
  8. 2325196Domain d1bkra_: 1bkr A: [17394]

Details for d1bkra_

PDB Entry: 1bkr (more details), 1.1 Å

PDB Description: calponin homology (ch) domain from human beta-spectrin at 1.1 angstrom resolution
PDB Compounds: (A:) spectrin beta chain

SCOPe Domain Sequences for d1bkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]}
ksakdalllwcqmktagypnvnihnfttswrdgmafnalihkhrpdlidfdklkksnahy
nlqnafnlaeqhlgltklldpedisvdhpdeksiityvvtyyhyfskm

SCOPe Domain Coordinates for d1bkra_:

Click to download the PDB-style file with coordinates for d1bkra_.
(The format of our PDB-style files is described here.)

Timeline for d1bkra_: