Lineage for d6zkvx_ (6zkv X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706327Species Sheep (Ovis aries) [TaxId:9940] [393976] (17 PDB entries)
  8. 2706346Domain d6zkvx_: 6zkv X: [394042]
    Other proteins in same PDB: d6zkv11, d6zkv12, d6zkv13, d6zkv4_, d6zkvg_
    automated match to d2qnwa_
    complexed with 3pe, amp, cdl, fes, fmn, k, myr, ndp, pc1, sf4, zmp, zn

Details for d6zkvx_

PDB Entry: 6zkv (more details), 2.9 Å

PDB Description: deactive complex i, open4
PDB Compounds: (X:) Acyl carrier protein

SCOPe Domain Sequences for d6zkvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zkvx_ a.28.1.0 (X:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
dappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfe
ipdidaeklmcpqeivdyiadkkdvye

SCOPe Domain Coordinates for d6zkvx_:

Click to download the PDB-style file with coordinates for d6zkvx_.
(The format of our PDB-style files is described here.)

Timeline for d6zkvx_: