Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species [nectria] haematococca [TaxId:660122] [393517] (1 PDB entry) |
Domain d6y0ha_: 6y0h A: [393518] automated match to d2vgda_ |
PDB Entry: 6y0h (more details), 1 Å
SCOPe Domain Sequences for d6y0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y0ha_ b.29.1.11 (A:) automated matches {[nectria] haematococca [TaxId: 660122]} rtqsstgthggyyysfwtdnpntvtytnqnagqfsvswsgnqgnfvggkgwnpgaartik ysgtynpngnsylavygwtrnplieyyivenfgtynpssgataagevtvdgsvydiytst rtnapsiegtrtfqqywsvrrnkrssgsvntgahfnawsnvglalgshdyqilavegyys sgsatmtvs
Timeline for d6y0ha_: