Lineage for d6y0ha_ (6y0h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780341Species [nectria] haematococca [TaxId:660122] [393517] (1 PDB entry)
  8. 2780342Domain d6y0ha_: 6y0h A: [393518]
    automated match to d2vgda_

Details for d6y0ha_

PDB Entry: 6y0h (more details), 1 Å

PDB Description: high resolution structure of gh11 xylanase from nectria haematococca
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d6y0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y0ha_ b.29.1.11 (A:) automated matches {[nectria] haematococca [TaxId: 660122]}
rtqsstgthggyyysfwtdnpntvtytnqnagqfsvswsgnqgnfvggkgwnpgaartik
ysgtynpngnsylavygwtrnplieyyivenfgtynpssgataagevtvdgsvydiytst
rtnapsiegtrtfqqywsvrrnkrssgsvntgahfnawsnvglalgshdyqilavegyys
sgsatmtvs

SCOPe Domain Coordinates for d6y0ha_:

Click to download the PDB-style file with coordinates for d6y0ha_.
(The format of our PDB-style files is described here.)

Timeline for d6y0ha_: