Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.12: eEF-1beta-like [54984] (1 family) automatically mapped to Pfam PF00736 |
Family d.58.12.1: eEF-1beta-like [54985] (3 proteins) |
Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54987] (1 PDB entry) |
Domain d1b64a_: 1b64 A: [39306] |
PDB Entry: 1b64 (more details)
SCOPe Domain Sequences for d1b64a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b64a_ d.58.12.1 (A:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Human (Homo sapiens) [TaxId: 9606]} mlvakssilldvkpwddetdmakleecvrsiqadglvwgssklvpvgygikklqiqcvve ddkvgtdmleeqitafedyvqsmdvaafnki
Timeline for d1b64a_: