SCOPe 2.08: Domain d1b64a_: 1b64 A:

Lineage for d1b64a_ (1b64 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.12: eEF-1beta-like [54984] (1 family)
   automatically mapped to Pfam PF00736

5. Family d.58.12.1: eEF-1beta-like [54985] (3 proteins)

6. Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54987] (1 PDB entry)

8. Domain d1b64a_: 1b64 A: [39306]

Details for d1b64a_

PDB Entry: 1b64

PDB Description: solution structure of the guanine nucleotide exchange factor domain from human elongation factor-one beta, nmr, 20 structures

PDB Compounds: (A:) elongation factor 1-beta

SCOPe Domain Sequences for d1b64a_:

Sequence; same for both SEQRES and ATOM records:

>d1b64a_ d.58.12.1 (A:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Human (Homo sapiens) [TaxId: 9606]}
mlvakssilldvkpwddetdmakleecvrsiqadglvwgssklvpvgygikklqiqcvve
ddkvgtdmleeqitafedyvqsmdvaafnki

Timeline for d1b64a_:

• d1b64a_ first appeared (with stable ids) in SCOP 1.55, called d1b64__
  
• d1b64a_ appears in SCOPe 2.07