Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.12: eEF-1beta-like [54984] (1 family) |
Family d.58.12.1: eEF-1beta-like [54985] (2 proteins) |
Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54987] (1 PDB entry) |
Domain d1b64__: 1b64 - [39306] |
PDB Entry: 1b64 (more details)
SCOP Domain Sequences for d1b64__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b64__ d.58.12.1 (-) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Human (Homo sapiens)} mlvakssilldvkpwddetdmakleecvrsiqadglvwgssklvpvgygikklqiqcvve ddkvgtdmleeqitafedyvqsmdvaafnki
Timeline for d1b64__: