Lineage for d1b64__ (1b64 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.12: eEF-1beta-like [54984] (1 family) 
Family d.58.12.1: eEF-1beta-like [54985] (2 proteins) Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [54987] (1 PDB entry) 
Domain d1b64__: 1b64 - [39306]
Details for d1b64__
PDB Entry: 1b64 (more details)
PDB Description: solution structure of the guanine nucleotide exchange factor domain from human elongation factor-one beta, nmr, 20 structures
SCOP Domain Sequences for d1b64__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b64__ d.58.12.1 (-) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Human (Homo sapiens)}
mlvakssilldvkpwddetdmakleecvrsiqadglvwgssklvpvgygikklqiqcvve
ddkvgtdmleeqitafedyvqsmdvaafnki
SCOP Domain Coordinates for d1b64__:
Click to download the PDB-style file with coordinates for d1b64__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b64__:
- d1b64__ appears in SCOP 1.57
- d1b64__ appears in the current release, SCOPe 2.08, called d1b64a_
View in 3D