Lineage for d1efga4 (1efg A:600-689)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953534Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 2953535Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 2953547Domain d1efga4: 1efg A:600-689 [39305]
    Other proteins in same PDB: d1efga1, d1efga2, d1efga3
    complexed with gdp

Details for d1efga4

PDB Entry: 1efg (more details), 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1efga4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efga4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

SCOPe Domain Coordinates for d1efga4:

Click to download the PDB-style file with coordinates for d1efga4.
(The format of our PDB-style files is described here.)

Timeline for d1efga4: