SCOPe 2.08: Domain d6vk8b_: 6vk8 B:

Lineage for d6vk8b_ (6vk8 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Methylosinus trichosporium [TaxId:595536] [392644] (12 PDB entries)

8. Domain d6vk8b_: 6vk8 B: [392730]
   Other proteins in same PDB: d6vk8c_, d6vk8d_, d6vk8g_, d6vk8h_
   automated match to d1mtyb_
   complexed with bez, edo, fe, sin

Details for d6vk8b_

PDB Entry: 6vk8, 2.03 Å

PDB Description: crystal structure of methylosinus trichosporium ob3b soluble methane monooxygenase hydroxylase and regulatory component complex with small organic carboxylate at active center

PDB Compounds: (B:) Methane monooxygenase

SCOPe Domain Sequences for d6vk8b_:

Sequence; same for both SEQRES and ATOM records:

>d6vk8b_ a.25.1.2 (B:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
pqssqvtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkrlseyeqlscyaqpnp
dwiaggldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearyt
qrflaayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtav
faaldkvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqd
wneilwaghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfv
yclandsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdragvsealqr
vfgdwkidyadkigfrvdvdqkvdavlagykn

Timeline for d6vk8b_:

• d6vk8b_ first appeared in SCOPe 2.07