Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (12 species) not a true protein |
Species Methylosinus trichosporium [TaxId:595536] [392644] (12 PDB entries) |
Domain d6vk8b_: 6vk8 B: [392730] Other proteins in same PDB: d6vk8c_, d6vk8d_, d6vk8g_, d6vk8h_ automated match to d1mtyb_ complexed with bez, edo, fe, sin |
PDB Entry: 6vk8 (more details), 2.03 Å
SCOPe Domain Sequences for d6vk8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vk8b_ a.25.1.2 (B:) automated matches {Methylosinus trichosporium [TaxId: 595536]} pqssqvtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkrlseyeqlscyaqpnp dwiaggldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearyt qrflaayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtav faaldkvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqd wneilwaghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfv yclandsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdragvsealqr vfgdwkidyadkigfrvdvdqkvdavlagykn
Timeline for d6vk8b_: