SCOPe 2.08: Domain d6viaa1: 6via A:1-174

Lineage for d6viaa1 (6via A:1-174)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
   Pfam PF06052; 3-HAO

6. Protein automated matches [311561] (3 species)
   not a true protein

7. Species Cupriavidus metallidurans [TaxId:266264] [347812] (11 PDB entries)

8. Domain d6viaa1: 6via A:1-174 [392694]
   Other proteins in same PDB: d6viaa2
   automated match to d4r52a_
   complexed with eay, fe, fe2, oh, trs

Details for d6viaa1

PDB Entry: 6via, 1.59 Å

PDB Description: observing a ring-cleaving dioxygenase in action through a crystalline lens - a seven-membered lactone bound structure

PDB Compounds: (A:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOPe Domain Sequences for d6viaa1:

Sequence; same for both SEQRES and ATOM records:

>d6viaa1 b.82.1.20 (A:1-174) automated matches {Cupriavidus metallidurans [TaxId: 266264]}
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa

Timeline for d6viaa1:

• d6viaa1 first appeared in SCOPe 2.07