Lineage for d6visb_ (6vis B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805235Protein automated matches [190295] (6 species)
    not a true protein
  7. 2805251Species Human (Homo sapiens) [TaxId:9606] [187133] (90 PDB entries)
  8. 2805408Domain d6visb_: 6vis B: [392640]
    automated match to d5u6ga_
    complexed with gol

Details for d6visb_

PDB Entry: 6vis (more details), 2.79 Å

PDB Description: the crystal structure of domain-swapped trimer q108k:k40d:t53a:r58l:q38f:q4f:v62e variant of hcrbpii
PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d6visb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6visb_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdfngtwemesnenfegymkaldidfatrkiavrltftdvidqdgdnfktkatstflny
dedftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d6visb_:

Click to download the PDB-style file with coordinates for d6visb_.
(The format of our PDB-style files is described here.)

Timeline for d6visb_: