Lineage for d6tvfe1 (6tvf E:1-318)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776713Domain d6tvfe1: 6tvf E:1-318 [392273]
    Other proteins in same PDB: d6tvfa2, d6tvfb_, d6tvfc2, d6tvfd_, d6tvfe2, d6tvff_, d6tvfg2, d6tvfh_, d6tvfi2, d6tvfj_, d6tvfl_
    automated match to d3ztna_
    complexed with ca, gal, nag, sia

Details for d6tvfe1

PDB Entry: 6tvf (more details), 2.6 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with human receptor analogue, 6'-sln
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d6tvfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvfe1 b.19.1.0 (E:1-318) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvngqsgridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d6tvfe1:

Click to download the PDB-style file with coordinates for d6tvfe1.
(The format of our PDB-style files is described here.)

Timeline for d6tvfe1: