SCOPe 2.08: Domain d6suga_: 6sug A:

Lineage for d6suga_ (6sug A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d6suga_: 6sug A: [391778]
   automated match to d1ttaa_
   complexed with lvb

Details for d6suga_

PDB Entry: 6sug, 1.21 Å

PDB Description: crystal structure of transthyretin in complex with 3-deoxytolcapone, a tolcapone analogue

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d6suga_:

Sequence; same for both SEQRES and ATOM records:

>d6suga_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d6suga_:

• d6suga_ first appeared in SCOPe 2.07