Lineage for d6m4ka2 (6m4k A:422-510)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811238Species Worm (Eisenia fetida) [TaxId:6396] [391055] (3 PDB entries)
  8. 2811239Domain d6m4ka2: 6m4k A:422-510 [391056]
    Other proteins in same PDB: d6m4ka1, d6m4ka3, d6m4ka4
    automated match to d1vaha1
    complexed with 1pe, act, ca, cl, pg4, so4

Details for d6m4ka2

PDB Entry: 6m4k (more details), 1.3 Å

PDB Description: x-ray crystal structure of wild type alpha-amylase i from eisenia fetida
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d6m4ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m4ka2 b.71.1.0 (A:422-510) automated matches {Worm (Eisenia fetida) [TaxId: 6396]}
wwdngfqaiafgrgnrgfifinnedfaitqtlqtglpggeycdviscdnnrppcgnsgga
cratvivngdgtatfdvpngenpmiaihv

SCOPe Domain Coordinates for d6m4ka2:

Click to download the PDB-style file with coordinates for d6m4ka2.
(The format of our PDB-style files is described here.)

Timeline for d6m4ka2: