Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Worm (Eisenia fetida) [TaxId:6396] [391055] (3 PDB entries) |
Domain d6m4ka2: 6m4k A:422-510 [391056] Other proteins in same PDB: d6m4ka1, d6m4ka3, d6m4ka4 automated match to d1vaha1 complexed with 1pe, act, ca, cl, pg4, so4 |
PDB Entry: 6m4k (more details), 1.3 Å
SCOPe Domain Sequences for d6m4ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m4ka2 b.71.1.0 (A:422-510) automated matches {Worm (Eisenia fetida) [TaxId: 6396]} wwdngfqaiafgrgnrgfifinnedfaitqtlqtglpggeycdviscdnnrppcgnsgga cratvivngdgtatfdvpngenpmiaihv
Timeline for d6m4ka2: