![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
![]() | Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) ![]() |
![]() | Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
![]() | Protein automated matches [254444] (10 species) not a true protein |
![]() | Species Thiorhodovibrio sp. [TaxId:631362] [389859] (1 PDB entry) |
![]() | Domain d7c9rr_: 7c9r R: [389916] Other proteins in same PDB: d7c9rc_, d7c9rh1, d7c9rh2, d7c9rl_, d7c9rm_ automated match to d1wrga_ complexed with 8k6, bcl, bph, ca, cdl, dga, fe, h4x, hem, lmt, mg, mq8, pgv, uq8 |
PDB Entry: 7c9r (more details), 2.82 Å
SCOPe Domain Sequences for d7c9rr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c9rr_ f.3.1.0 (R:) automated matches {Thiorhodovibrio sp. [TaxId: 631362]} eksttglteaeskefhgifmasmtlwfglvvlahilswlyrpwl
Timeline for d7c9rr_:
![]() Domains from other chains: (mouse over for more information) d7c9r0_, d7c9r1_, d7c9r2_, d7c9r3_, d7c9r4_, d7c9r5_, d7c9r6_, d7c9r7_, d7c9r8_, d7c9ra_, d7c9rb_, d7c9rc_, d7c9rd_, d7c9re_, d7c9rf_, d7c9rg_, d7c9rh1, d7c9rh2, d7c9ri_, d7c9rj_, d7c9rk_, d7c9rl_, d7c9rm_, d7c9rn_, d7c9ro_, d7c9rp_, d7c9rs_, d7c9rt_, d7c9ru_, d7c9rv_, d7c9rw_, d7c9rx_, d7c9ry_, d7c9rz_ |