Lineage for d1frx__ (1frx -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein) Protein Ferredoxin [54871] (2 species) Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries) 
Domain d1frx__: 1frx - [38981]
Details for d1frx__
PDB Entry: 1frx (more details), 2.5 Å
PDB Description: structure and properties of c20s fdi mutant
SCOP Domain Sequences for d1frx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frx__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevspvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
SCOP Domain Coordinates for d1frx__:
Click to download the PDB-style file with coordinates for d1frx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1frx__:
- d1frx__ first appeared (with stable ids) in SCOP 1.55
- d1frx__ appears in SCOP 1.59
- d1frx__ appears in the current release, SCOPe 2.08, called d1frxa_
View in 3D