PDB entry 1frx

View 1frx on RCSB PDB site
Description: structure and properties of c20s fdi mutant
Deposited on 1994-07-13, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1frx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1frx_ (-)
afvvtdncikckytdcvevspvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler