Lineage for d6fd1__ (6fd1 -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein) Protein Ferredoxin [54871] (2 species) Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries) 
Domain d6fd1__: 6fd1 - [38949]
Details for d6fd1__
PDB Entry: 6fd1 (more details), 1.35 Å
PDB Description: 7-fe ferredoxin from azotobacter vinelandii low temperature, 1.35 a
SCOP Domain Sequences for d6fd1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fd1__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
SCOP Domain Coordinates for d6fd1__:
Click to download the PDB-style file with coordinates for d6fd1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6fd1__:
- d6fd1__ first appeared (with stable ids) in SCOP 1.55
- d6fd1__ appears in SCOP 1.59
- d6fd1__ appears in the current release, SCOPe 2.08, called d6fd1a_
View in 3D